Muntiacus reevesi (Reeves' muntjac): 136173296 Help Entry 136173296         CDS       T10466                                  Name (RefSeq) stefin-C-like   KO K13907   cystatin-A/B Organism mree  Muntiacus reevesi (Reeves' muntjac) Brite KEGG Orthology (KO) [BR:mree00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mree01002]     136173296   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136173296 Peptidases and inhibitors [BR:mree01002]  Peptidase inhibitors   Family I25: cystatin family    136173296 Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    136173296 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Motif Other DBs NCBI-GeneID:  136173296 NCBI-ProteinID:  XP_065798889 LinkDB All DBs Position 8:complement(23559467..23564371) Genome browser AA seq 101 aa AA seqDB search MLGPKVGGFSETQAATAKTQAITDQVKSQLEEKVDKKFPMFKAVEFRSQVVAGMNYLIKV QVDEDEFVHIRVFESLPHESKPVALTSYQTNKGRHDELAEF NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgttggggccaaaggttggtgggttctcagagactcaggctgccacagccaagacccag gccatcactgatcaggtgaagtcccagctggaggagaaggtggacaagaagttcccaatg ttcaaggctgtggaattcaggagccaggtggtcgccggaatgaactacttgatcaaggtt caagtggacgaggatgagttcgtgcacatccgagtgtttgaaagcctcccgcacgagagc aagcccgtggccttgaccagctaccagaccaacaaaggcaggcatgacgagctggcggaa ttctag

DBGET integrated database retrieval system