Muntiacus reevesi (Reeves' muntjac): 136173359 Help Entry 136173359         CDS       T10466                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04015   Rap1 signaling pathway mree04810   Regulation of actin cytoskeleton mree05014   Amyotrophic lateral sclerosis mree05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     136173359 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136173359 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136173359 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136173359 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136173359 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mree04812]     136173359 (PFN2)    04147 Exosome [BR:mree04147]     136173359 (PFN2) Membrane trafficking [BR:mree04131]  Others   Actin-binding proteins    Others     136173359 (PFN2) Cytoskeleton proteins [BR:mree04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      136173359 (PFN2) Exosome [BR:mree04147]  Exosomal proteins   Proteins found in most exosomes    136173359 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  136173359 NCBI-ProteinID:  XP_065798999 LinkDB All DBs Position 8:93108262..93114600 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaagtacgtctgggcagccacggccggcggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctgtacgtg gatggcgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgcggtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggccaagtacttgagagactcggggttc tag

DBGET integrated database retrieval system