Muntiacus reevesi (Reeves' muntjac): 136173361 Help Entry 136173361         CDS       T10466                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04014   Ras signaling pathway mree04137   Mitophagy - animal mree04144   Endocytosis mree04145   Phagosome mree04148   Efferocytosis mree04962   Vasopressin-regulated water reabsorption mree05014   Amyotrophic lateral sclerosis mree05022   Pathways of neurodegeneration - multiple diseases mree05132   Salmonella infection mree05146   Amoebiasis mree05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     136173361 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     136173361 (RAB5A)    04145 Phagosome     136173361 (RAB5A)    04137 Mitophagy - animal     136173361 (RAB5A)    04148 Efferocytosis     136173361 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     136173361 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136173361 (RAB5A)    05152 Tuberculosis     136173361 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     136173361 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136173361 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     136173361 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136173361 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136173361 (RAB5A)    04031 GTP-binding proteins [BR:mree04031]     136173361 (RAB5A) Membrane trafficking [BR:mree04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     136173361 (RAB5A)  Endosome - Lysosome transport     136173361 (RAB5A) Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136173361 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    136173361 (RAB5A)   Exosomal proteins of colorectal cancer cells    136173361 (RAB5A)   Exosomal proteins of bladder cancer cells    136173361 (RAB5A) GTP-binding proteins [BR:mree04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     136173361 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  136173361 NCBI-ProteinID:  XP_065799001 LinkDB All DBs Position 8:36018483..36047789 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSTRGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggcgcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcgagccttgtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccatcggggctgcttttctaactcaa acggtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacggctggtcaagaa cggtaccatagcctagcgcccatgtactacagaggagcccaggcagccatagttgtgtac gatatcacgaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggccgatctggcaaataaa agagctgttgacttccaggaggcacagtcctatgcagatgataacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaactctaccagaggaagaggagtagac ctgactgagcccacacagcccaccaggagtcagtgctgcagtaactag

DBGET integrated database retrieval system