Muntiacus reevesi (Reeves' muntjac): 136173428 Help Entry 136173428         CDS       T10466                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04060   Cytokine-cytokine receptor interaction mree04620   Toll-like receptor signaling pathway mree04622   RIG-I-like receptor signaling pathway mree04625   C-type lectin receptor signaling pathway mree04630   JAK-STAT signaling pathway mree04658   Th1 and Th2 cell differentiation mree04936   Alcoholic liver disease mree04940   Type I diabetes mellitus mree05133   Pertussis mree05134   Legionellosis mree05140   Leishmaniasis mree05142   Chagas disease mree05143   African trypanosomiasis mree05144   Malaria mree05145   Toxoplasmosis mree05146   Amoebiasis mree05152   Tuberculosis mree05162   Measles mree05164   Influenza A mree05168   Herpes simplex virus 1 infection mree05171   Coronavirus disease - COVID-19 mree05200   Pathways in cancer mree05321   Inflammatory bowel disease mree05330   Allograft rejection mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     136173428 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136173428 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136173428 (IL12A)    04622 RIG-I-like receptor signaling pathway     136173428 (IL12A)    04625 C-type lectin receptor signaling pathway     136173428 (IL12A)    04658 Th1 and Th2 cell differentiation     136173428 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136173428 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     136173428 (IL12A)    05164 Influenza A     136173428 (IL12A)    05162 Measles     136173428 (IL12A)    05168 Herpes simplex virus 1 infection     136173428 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     136173428 (IL12A)    05134 Legionellosis     136173428 (IL12A)    05152 Tuberculosis     136173428 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     136173428 (IL12A)    05144 Malaria     136173428 (IL12A)    05145 Toxoplasmosis     136173428 (IL12A)    05140 Leishmaniasis     136173428 (IL12A)    05142 Chagas disease     136173428 (IL12A)    05143 African trypanosomiasis     136173428 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     136173428 (IL12A)    05330 Allograft rejection     136173428 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136173428 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     136173428 (IL12A)    04936 Alcoholic liver disease     136173428 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136173428 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:mree00536]     136173428 (IL12A) Cytokines and neuropeptides [BR:mree04052]  Cytokines   Interleukins    136173428 (IL12A) Glycosaminoglycan binding proteins [BR:mree00536]  Heparan sulfate / Heparin   Cytokines    136173428 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  136173428 NCBI-ProteinID:  XP_065799127 LinkDB All DBs Position 8:complement(83196233..83203207) Genome browser AA seq 221 aa AA seqDB search MRPLRSLLLLSTLVLLHRLPHPSLGRSLAPSTAGPGRSCLNYSQNLLRAVSDTLQKARQT LEFYSCTSEEIEHEDITKDKTSTVEACLPLELATNESCLVSRESSLITHGSCLASGKTSF MTTLCLKSIYEDLKMYHMEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNFNSETVP QKPSLEEMDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS NT seq 666 nt NT seq  +upstreamnt  +downstreamnt atgcgcccacttcgcagcctcctcctcctgtccaccctggtcctcctccaccgcctgccc caccccagtttgggcaggagcctcgccccgagcacagcaggcccaggaaggagttgcctc aactactcccaaaacctgctgagggccgtcagcgacacactgcagaaggccagacaaacc ctagaattttactcctgcacttctgaggagatcgagcatgaagatatcaccaaagataaa accagcacagtggaggcctgtttaccactggaattagccacgaatgagagttgcctggtt tccagagagagctctttaataactcatgggagttgtctggcttctggaaagacctctttt atgacaaccctgtgccttaaaagtatctacgaggacttgaagatgtaccacatggagttc caggccatgaatgcaaagcttctgatggatcctaagaggcagatctttctagaccagaac atgctggcagctattgctgagctgatgcaggccctgaatttcaacagtgagactgtgcca cagaaaccctccctggaagaaatggatttttacaagacaaaagtcaagctctgcatcctt cttcacgccttcagaattcgtgcggtgaccatcgacagaatgatgagctatctgagttct tcctag

DBGET integrated database retrieval system