Muntiacus reevesi (Reeves' muntjac): 136174048 Help Entry 136174048         CDS       T10466                                  Symbol H2AX Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree03082   ATP-dependent chromatin remodeling mree04217   Necroptosis mree04613   Neutrophil extracellular trap formation mree05034   Alcoholism mree05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mree00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     136174048 (H2AX)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136174048 (H2AX)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136174048 (H2AX)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     136174048 (H2AX)   09165 Substance dependence    05034 Alcoholism     136174048 (H2AX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mree03036]     136174048 (H2AX)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136174048 (H2AX) Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136174048 (H2AX) Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136174048 (H2AX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  136174048 NCBI-ProteinID:  XP_065799922 LinkDB All DBs Position 9:62167855..62169175 Genome browser AA seq 143 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPAGGKKATQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgcggcaagaccggcggcaaggcccgcgccaaggccaagtcgcgctcttcg cgagcgggcctccagtttcccgtgggccgcgtgcaccggctgctgcggaagggccactac gccgagagggtgggcgccggcgcgccggtctacctggcggcggtactcgagtacctcacc gctgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcggataatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgacgatcgcccagggaggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accagcgccaccgtggggccaaaggcgcccgcgggcggcaagaaggccacccaggcctct caggagtactga

DBGET integrated database retrieval system