Muntiacus reevesi (Reeves' muntjac): 136176296 Help Entry 136176296         CDS       T10466                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04010   MAPK signaling pathway mree04020   Calcium signaling pathway mree04022   cGMP-PKG signaling pathway mree04114   Oocyte meiosis mree04218   Cellular senescence mree04310   Wnt signaling pathway mree04360   Axon guidance mree04370   VEGF signaling pathway mree04380   Osteoclast differentiation mree04625   C-type lectin receptor signaling pathway mree04650   Natural killer cell mediated cytotoxicity mree04658   Th1 and Th2 cell differentiation mree04659   Th17 cell differentiation mree04660   T cell receptor signaling pathway mree04662   B cell receptor signaling pathway mree04720   Long-term potentiation mree04724   Glutamatergic synapse mree04921   Oxytocin signaling pathway mree04922   Glucagon signaling pathway mree04924   Renin secretion mree05010   Alzheimer disease mree05014   Amyotrophic lateral sclerosis mree05020   Prion disease mree05022   Pathways of neurodegeneration - multiple diseases mree05031   Amphetamine addiction mree05152   Tuberculosis mree05163   Human cytomegalovirus infection mree05166   Human T-cell leukemia virus 1 infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05170   Human immunodeficiency virus 1 infection mree05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136176296 (PPP3R2)    04310 Wnt signaling pathway     136176296 (PPP3R2)    04370 VEGF signaling pathway     136176296 (PPP3R2)    04020 Calcium signaling pathway     136176296 (PPP3R2)    04022 cGMP-PKG signaling pathway     136176296 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     136176296 (PPP3R2)    04218 Cellular senescence     136176296 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136176296 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     136176296 (PPP3R2)    04660 T cell receptor signaling pathway     136176296 (PPP3R2)    04658 Th1 and Th2 cell differentiation     136176296 (PPP3R2)    04659 Th17 cell differentiation     136176296 (PPP3R2)    04662 B cell receptor signaling pathway     136176296 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     136176296 (PPP3R2)    04921 Oxytocin signaling pathway     136176296 (PPP3R2)    04924 Renin secretion     136176296 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     136176296 (PPP3R2)    04720 Long-term potentiation     136176296 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     136176296 (PPP3R2)    04380 Osteoclast differentiation     136176296 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     136176296 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136176296 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     136176296 (PPP3R2)    05163 Human cytomegalovirus infection     136176296 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     136176296 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     136176296 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     136176296 (PPP3R2)    05014 Amyotrophic lateral sclerosis     136176296 (PPP3R2)    05020 Prion disease     136176296 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     136176296 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     136176296 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136176296 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mree01009]     136176296 (PPP3R2) Protein phosphatases and associated proteins [BR:mree01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      136176296 (PPP3R2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF_SSP120 EF-hand_FSTL1 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  136176296 NCBI-ProteinID:  XP_065802528 LinkDB All DBs Position 10:complement(23035984..23036496) Genome browser AA seq 170 aa AA seqDB search MGNEASYPAEICSHFDEDEIKRLGKRFKKLDLDSSGAVSVKEFTSMPELRENPLVQRVID VFDTDGDGQVDFREFILGTSQFSVRGDEQQKLRFAFSIYDLDRDGYISNGELFQVLKMMV GDSLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEVHKHLVTVV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaacgaggccagttacccggcggagatatgctcgcactttgacgaagacgaaatt aaaaggctgggcaagcggtttaagaagctggacttggacagttccggcgctgtgagcgtc aaagagttcacgtccatgccggagctgcgggagaacccgctggtgcagcgggtgatcgac gtcttcgacaccgacggcgacggacaggtggacttccgggaattcatcctggggacctcc cagttcagcgtccggggagatgagcagcagaagctgaggtttgctttcagcatctacgac ctggacagagacggctacatttccaacggggagctcttccaggtgctgaagatgatggtc ggggacagcctcaaagactggcagttacagcagctggtggacaaaaccatcatcctcttg gacaaggatggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg gaggtccacaagcacttggtgactgttgtgtga

DBGET integrated database retrieval system