Muntiacus reevesi (Reeves' muntjac): 805178 Help Entry 805178            CDS       T10466                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree00190   Oxidative phosphorylation mree01100   Metabolic pathways mree04714   Thermogenesis mree04723   Retrograde endocannabinoid signaling mree05010   Alzheimer disease mree05012   Parkinson disease mree05014   Amyotrophic lateral sclerosis mree05016   Huntington disease mree05020   Prion disease mree05022   Pathways of neurodegeneration - multiple diseases mree05208   Chemical carcinogenesis - reactive oxygen species mree05415   Diabetic cardiomyopathy Module mree_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:mree00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     805178 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     805178 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     805178 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     805178 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     805178 (ND4L)    05012 Parkinson disease     805178 (ND4L)    05014 Amyotrophic lateral sclerosis     805178 (ND4L)    05016 Huntington disease     805178 (ND4L)    05020 Prion disease     805178 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     805178 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     805178 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mree03029]     805178 (ND4L) Enzymes [BR:mree01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      805178 (ND4L) Mitochondrial biogenesis [BR:mree03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     805178 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  805178 NCBI-ProteinID:  NP_663800 UniProt:  Q7IVV6 LinkDB All DBs Position MT: Genome browser AA seq 98 aa AA seqDB search MSLVYMNIMTAFMVSLAGLLMYRSHLMSSLLCLEGMMLSLFVLATLTILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctctagtatatataaatatcataacagcatttatagtatcccttgcaggactatta atatatcgatcccacctcatgtcctccctcctatgcttagaaggtatgatgctatcccta tttgtattagctaccttaacgattttaaactctcatttcaccctagcaagcatgatacct attattttactagttttcgcagcttgcgaagcagcactaggactatccctgctagtaata gtatcaaatacatacggtactgactatgtccaaaacctcaatttacttcaatgctaa

DBGET integrated database retrieval system