KEGG   Mycolicibacterium rhodesiae: MycrhN_3159
Entry
MycrhN_3159       CDS       T01685                                 
Name
(GenBank) ring-hydroxylating dioxygenase, large terminal subunit
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00624  Polycyclic aromatic hydrocarbon degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MycrhN_3159
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     MycrhN_3159
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AEV73692
UniProt: G8RMM5
LinkDB
Position
3167555..3168922
AA seq 455 aa
MTTETTGTADATDPYLRLALRDVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVFLGH
ESELTKSGDFVVRHIGADSVIVCRDSSGRIQALSNSCRHRGALVCRAEMGNTEHFQCPYH
GWVYSNTGELVGVPAMREAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTDYLG
DTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAP
GDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMAASYPSPAHKDMMR
RSAFIHGTVFPNLSFINVTIAPDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDAPEW
LRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGAGLLNYEMGMDLTPLTDWPG
PGEALPSGYAEQNQRRFWGRWLEYMGQPAAFGGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccggaacagctgacgcgaccgatccctacctgcggctcgcgttg
cgcgacgtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtcagcgatcct
gcgctgcacacgatcgagatggagcggatcttcggacgagcctgggtgttcctcggacat
gagtcggagttgaccaagtccggcgacttcgtcgtgcggcacatcggggccgattcggtg
atcgtttgccgggacagctccggccggatccaggcgctgtccaattcttgtcgacaccgt
ggtgcgctcgtgtgccgggcggagatgggaaacaccgagcacttccagtgcccgtaccac
ggctgggtgtacagcaacaccggcgagctcgttggtgtgccggcgatgagggaggcctat
cccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtcgactcttac
gccggattcatcttcggcagcgttgatccgaaggcgcccagtctgaccgactacctcggc
gacacgacgttctacctcgacctcattgcgaagaagacggcgggcggtctggaggtgata
ggggcaccgcaccgatgggtgatgtcggcgaactggaagacagccgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctccatggtcgagctgggaatggcgccc
ggtgacccgaacttcgcgagcgcaccagcggagatctcgctgcagaacggccacggcgtc
ggcgtactcggctttccgcccacgctcgccgattttcccgagtacgagggataccccgac
gaagtcgtcgaccagatggcggcgtcctatccgtcgccggcacacaaggacatgatgcga
cgctcggcctttattcacggcaccgtgttcccgaatttgtcgttcatcaacgtgaccatc
gcgccggaccatatgtcgccccctacccccttcatcacgttccgggtgtggcatccgctc
tctcatgatcggatggaaatcctctcctggttcctggtcgaacgcgacgctccggaatgg
ctgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccgggcggtgttttcgaa
caggacgacgccgaggcatggaaggccatcaccgaatctgtccagggtccgttcgccggt
gcaggactgctgaactacgagatgggcatggacttgactccgctcaccgactggccaggg
ccgggagaggctctcccgagcgggtacgccgagcagaaccagcggcggttttgggggaga
tggctggaatacatgggccaacctgccgcattcggtgggcgtgcttga

DBGET integrated database retrieval system