Mycolicibacterium rhodesiae: MycrhN_6152 Help Entry MycrhN_6152       CDS       T01685                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mrh  Mycolicibacterium rhodesiae Pathway mrh00998   Biosynthesis of various antibiotics mrh01100   Metabolic pathways mrh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mrh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MycrhN_6152    00074 Mycolic acid biosynthesis     MycrhN_6152   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MycrhN_6152 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEV76612 UniProt:  G8RTP9 LinkDB All DBs Position 6228323..6228592 Genome browser AA seq 89 aa AA seqDB search MKPSTPEAVSAALTEILRDDMNVDVRRVTPESRLIDDVGLDSVAFAVGMVAIEDKLGVAL SEEDLLSCDTVGDLEAAILIKVPAAQANS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgaagccgtctactcccgaagcggtgagcgccgctctcaccgaaatcctgcgcgacgac atgaatgtcgatgttcggcgggtcaccccggaatcgagactgatcgacgatgtcggactc gactcggtggcgttcgcggtcggaatggtcgccatcgaggacaagctcggtgtcgcgctg tccgaggaagatctgctcagctgtgacaccgtcggcgacctcgaagcagccatcctcatc aaggtgcctgcggctcaggcgaactcatga

DBGET integrated database retrieval system