Maioricimonas rarisocia: Mal4_09350 Help Entry Mal4_09350        CDS       T06940                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mri  Maioricimonas rarisocia Pathway mri01100   Metabolic pathways mri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mal4_09350 (acpP_1)    00074 Mycolic acid biosynthesis     Mal4_09350 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mal4_09350 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QDU36647 UniProt:  A0A517Z2F5 LinkDB All DBs Position complement(1218362..1218598) Genome browser AA seq 78 aa AA seqDB search MAIEEQVIAIVSEQLSVPQEDISRESSFIEDLKADSLDVVELVMAFEDKFGVTIPDDDYE KIRTVGDAIDYIEQQENA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtggcgatcgaagaacaggtaattgcgattgtcagcgagcaactgagcgtcccgcaggaa gacatttcccgcgaaagctcgtttatcgaagacctgaaggccgactctctcgacgtcgtc gaactggtcatggctttcgaagacaaattcggggtcaccatccccgacgacgactacgaa aaaattcggaccgtcggcgatgcgattgactacatcgagcagcaggagaatgcgtga

DBGET integrated database retrieval system