Methanobacterium aridiramus: FGU46_07930 Help Entry FGU46_07930       CDS       T10862                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mrid  Methanobacterium aridiramus Pathway mrid03010   Ribosome Brite Ribosome [BR:mrid03011]  Ribosomal proteins   Eukaryotes    Small subunit     FGU46_07930   Archaea     FGU46_07930 Ubiquitin system [BR:mrid04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FGU46_07930 Exosome [BR:mrid04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    FGU46_07930   Exosomal proteins of colorectal cancer cells    FGU46_07930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  WJI10021 LinkDB All DBs Position complement(1491991..1492152) Genome browser AA seq 53 aa AA seqDB search MKKYQLYEVKDNKLVRKNPECVRCSHGVFMADHGDRYTCGKCGYTQWKGKEKK NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagtaccagctttacgaagttaaagataacaaactcgtccgtaaaaatccggag tgtgtgcgatgctcccacggagtcttcatggctgaccatggagaccgctacacctgcggt aaatgcggatacacccaatggaaaggtaaagaaaagaaatag

DBGET integrated database retrieval system