KEGG Orthology (KO) [BR:mrj00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04120 Ubiquitin mediated proteolysis
136852313 (EloB)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:mrj04121]
136852313 (EloB)
03400 DNA repair and recombination proteins [BR:mrj03400]
136852313 (EloB)
Ubiquitin system [BR:mrj04121]
Ubiquitin ligases (E3)
Multi subunit type E3
Cul2 complex
Adoptor protein
136852313 (EloB)
Cul5 complex
136852313 (EloB)
DNA repair and recombination proteins [BR:mrj03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
Other NER factors
136852313 (EloB)
146 aa
MILYFNRHEEYSNQLKNNSTYNGRLEVISFDVFLMVRRKKTTIFTDAKETTTVRELKKII
QGIMKVEPENQQLMNERGSEVFDDEKQLSDYNLTAQTARAQSPATVALVFRQDNGEFENL
EITPLSSPPELPEVMKPQEPQPHEIN