Metabacillus rhizosphaerae: WCV66_04530 Help Entry WCV66_04530       CDS       T10831                                  Name (GenBank) 2-hydroxymuconate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism mrl  Metabacillus rhizosphaerae Pathway mrl00362   Benzoate degradation mrl00621   Dioxin degradation mrl00622   Xylene degradation mrl01100   Metabolic pathways mrl01120   Microbial metabolism in diverse environments mrl01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:mrl00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     WCV66_04530    00622 Xylene degradation     WCV66_04530    00621 Dioxin degradation     WCV66_04530 Enzymes [BR:mrl01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      WCV66_04530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 CHMI MIF Motif Other DBs NCBI-ProteinID:  WXB89510 LinkDB All DBs Position complement(932852..933037) Genome browser AA seq 61 aa AA seqDB search MPYVTVKMLEGRTDEQKRALVEKVTAAVSETTGAPAEKIAVFIDEMSKSNYALGGKRLSD Q NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccatacgtaacagttaaaatgcttgaaggaagaacagacgagcaaaaaagagcctta gtcgaaaaagtaactgccgctgtatccgaaacaactggggcacccgctgaaaaaattgct gtctttatcgatgaaatgagcaaaagcaattatgcactcggtggtaagagattaagcgac caatag

DBGET integrated database retrieval system