Minicystis rosea: A7982_00781 Help Entry A7982_00781       CDS       T04613                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mrm  Minicystis rosea Pathway mrm00998   Biosynthesis of various antibiotics mrm01100   Metabolic pathways mrm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mrm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7982_00781    00074 Mycolic acid biosynthesis     A7982_00781   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7982_00781 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Docking PRD Motif Other DBs NCBI-ProteinID:  APR75435 LinkDB All DBs Position complement(862718..862987) Genome browser AA seq 89 aa AA seqDB search MEDEQGAIRDALKRVLVETLSLPVLPAQIDDDEPLFEAGLGVDSVEALALVNAIERRFGV RIPDDEIGIGMFQDIRSLAEVVSRIGATP NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaggacgagcaaggtgccattcgcgacgcgctcaagcgcgtcctcgtcgagacgctc tcgctccccgtgctgccggcgcagatcgacgacgacgagcccctcttcgaggccggcctc ggcgtcgattcggtggaggctttggccctcgtgaacgccatcgagcgacgcttcggcgtg cgcatccccgatgacgagatcggaattggcatgttccaggacattcgctctctggccgag gtcgtgagccgaatcggagccacgccatga

DBGET integrated database retrieval system