Minicystis rosea: A7982_04887 Help Entry A7982_04887       CDS       T04613                                  Name (GenBank) Hypothetical protein   KO K02078   acyl carrier protein Organism mrm  Minicystis rosea Pathway mrm00998   Biosynthesis of various antibiotics mrm01100   Metabolic pathways mrm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mrm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7982_04887    00074 Mycolic acid biosynthesis     A7982_04887   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7982_04887 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  APR79540 LinkDB All DBs Position complement(5654998..5655246) Genome browser AA seq 82 aa AA seqDB search MNSSRDVLSMFKQVAARVDKREFPHVTRASVITELGIDSLSMMQIVGEMETELGVMIPDE DLVEITTVGDLCSKVEQRLGAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaacagctcccgtgacgtcctttcgatgttcaagcaggttgccgctcgcgtggacaag cgcgagttcccgcacgtgacgcgcgcctcggtgatcaccgagctcggcatcgactccctc tcgatgatgcagatcgtcggcgagatggagacggagctcggggtgatgatccccgacgag gacctggtggagatcaccacggtcggcgatctgtgcagcaaggtggagcagcgcctcggc gctgcgtga

DBGET integrated database retrieval system