Melioribacter roseus: MROS_2189 Help Entry MROS_2189         CDS       T02176                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism mro  Melioribacter roseus Pathway mro02020   Two-component system mro02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:mro00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     MROS_2189  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     MROS_2189  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:mro02035]     MROS_2189 Bacterial motility proteins [BR:mro02035]  Flagellar system   Flagellar assembly proteins    Others     MROS_2189 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM CEP19 SNaCT8 XkdW Motif Other DBs NCBI-ProteinID:  AFN75419 UniProt:  I6ZTU8 LinkDB All DBs Position 2556771..2557031 Genome browser AA seq 86 aa AA seqDB search MDIKGISNNSTFTHDPNQLKKASVKQPEVKETDKIEISSTARELAKNEAASKKLEEIKQK ISSKFYDSDEVINKVAEAILKELKES NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggacataaaaggaatatcgaataattcgacgtttacacacgacccaaatcagttgaag aaggcttcggttaagcagccggaagtaaaagagaccgacaaaatcgagatctcttcgact gcgagagaactcgcaaaaaacgaagccgcttcaaagaaattggaggaaataaagcagaaa atcagttcgaaattttacgattcggacgaagtaattaataaagtagccgaggcaatctta aaagaattaaaagaaagttag

DBGET integrated database retrieval system