Moniliophthora roreri: Moror_1302 Help Entry Moror_1302        CDS       T03137                                  Name (GenBank) cdc42p   KO K04393   cell division control protein 42 Organism mrr  Moniliophthora roreri Pathway mrr04011   MAPK signaling pathway - yeast mrr04144   Endocytosis mrr04517   IgSF CAM signaling mrr04518   Integrin signaling mrr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mrr00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     Moror_1302   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     Moror_1302    04518 Integrin signaling     Moror_1302  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     Moror_1302  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     Moror_1302  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mrr04131]     Moror_1302    03036 Chromosome and associated proteins [BR:mrr03036]     Moror_1302   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mrr04147]     Moror_1302    04031 GTP-binding proteins [BR:mrr04031]     Moror_1302 Membrane trafficking [BR:mrr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Moror_1302  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     Moror_1302   Macropinocytosis    Ras GTPases     Moror_1302 Chromosome and associated proteins [BR:mrr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     Moror_1302 Exosome [BR:mrr04147]  Exosomal proteins   Exosomal proteins of microglial cells    Moror_1302   Exosomal proteins of breast milk    Moror_1302 GTP-binding proteins [BR:mrr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Moror_1302 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-ProteinID:  ESK88271 UniProt:  V2X655 LinkDB All DBs AA seq 192 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGEDPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLR DDAQVIDKLARQKQRPVASDQGERLARELGAVKYVECSALTQKGLKNVFDEAIVAALEPP VVKKSRKGCVVF NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcagacgatcaagtgtgtagttgttggtgatggtgccgtcggtaagacctgtctgttg atctcatataccaccaacaagttcccaagtgaatatgtcccgaccgtctttgacaactat gctgtcaccgtcatgattggagaggacccttatacattgggcttgtttgatacagctggt caggaggattacgaccgtcttcgtcctctatcttacccgcagacggatgtcttcctcgtc tgcttcagtgtaacatcgcctgcatcgttcgagaacgtgaaggagaagtggttcccagag gttcaccaccattgtcccggtgttccttgccttattgttggcacgcaaattgacttgcgg gatgacgcccaagtgatagacaaacttgcgagacaaaagcagagaccagtggcaagcgat cagggtgaaaggcttgccagggaacttggtgccgtcaagtatgtagagtgctcagcattg acgcagaagggcttgaagaacgtcttcgatgaggcaatcgtcgcggcccttgaaccacct gtcgtcaagaagtcgagaaaggggtgtgtcgtcttctga

DBGET integrated database retrieval system