Malassezia restricta: MRET_2561 Help Entry MRET_2561         CDS       T06113                                  Name (RefSeq) ubiquitin related modifier 1   KO K12161   ubiquitin related modifier 1 Organism mrt  Malassezia restricta Pathway mrt04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:mrt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     MRET_2561  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:mrt03016]     MRET_2561    04121 Ubiquitin system [BR:mrt04121]     MRET_2561 Transfer RNA biogenesis [BR:mrt03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     MRET_2561 Ubiquitin system [BR:mrt04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    MRET_2561 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 ThiS YajC Motif Other DBs NCBI-GeneID:  38739327 NCBI-ProteinID:  XP_027485154 LinkDB All DBs Position IV:join(311729..311769,311813..312101) Genome browser AA seq 109 aa AA seqDB search MGEAQDVRVIVEFGGGTELLLAPPHAKTHDIVLPASASDGGNRPTMSTLVEYIRTHLIKE REELFVENDHVRPGILVLVNDSDWELEGEMCYELKSGDRVVFISTLHGG NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgggagaagcgcaagatgtgcgcgtaatcgtcgagtttggcggtggtacagaattgttg cttgctccaccgcatgccaagacgcacgacattgtattaccagcatcggcgtctgatgga ggcaacagacccaccatgagcaccttggtggaatatattcgtacacacctgatcaaagag cgcgaagagctttttgtggagaatgatcatgttaggccgggtattctcgttctcgttaac gatagcgattgggaactcgagggtgaaatgtgctacgaactaaagtcaggggaccgggtt gtcttcattagtacattgcatggtggttaa

DBGET integrated database retrieval system