Methanospirillum purgamenti: KHC33_02615 Help Entry KHC33_02615       CDS       T07306                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mrtj  Methanospirillum purgamenti Pathway mrtj03010   Ribosome Brite KEGG Orthology (KO) [BR:mrtj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     KHC33_02615   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     KHC33_02615  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mrtj03011]     KHC33_02615    04121 Ubiquitin system [BR:mrtj04121]     KHC33_02615   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mrtj04147]     KHC33_02615 Ribosome [BR:mrtj03011]  Ribosomal proteins   Eukaryotes    Small subunit     KHC33_02615   Archaea     KHC33_02615 Ubiquitin system [BR:mrtj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    KHC33_02615 Exosome [BR:mrtj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    KHC33_02615   Exosomal proteins of colorectal cancer cells    KHC33_02615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 IBR Ribosomal_L37e Zn_ribbon_Nudix MqsA_antitoxin Lar_restr_allev Zn_ribbon_13 Cas12f1-like_TNB Zn_ribbon_NUD Motif Other DBs NCBI-ProteinID:  QVV89441 UniProt:  A0A8E7B1Q4 LinkDB All DBs Position complement(540102..540287) Genome browser AA seq 61 aa AA seqDB search MAAKGKKTEKAAVKRSAYFKVEGKNAVPQRRYCPRCGPGVFMGEHKDRVTCGKCGYTEFK K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggcagcaaaaggtaaaaaaacagaaaaggctgcagtcaagcggtctgcctatttcaaa gttgaaggaaagaatgcagttcctcagcgcaggtactgtccccggtgtgggccgggtgtt tttatgggtgagcacaaagaccgtgtcacctgtggaaaatgcggctacactgaatttaag aagtaa

DBGET integrated database retrieval system