Mauremys reevesii (Reeves's turtle): 120388368 Help Entry 120388368         CDS       T07797                                  Name (RefSeq) ras-like protein isoform X1   KO K07827   GTPase KRas Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04010   MAPK signaling pathway mrv04012   ErbB signaling pathway mrv04068   FoxO signaling pathway mrv04137   Mitophagy - animal mrv04140   Autophagy - animal mrv04150   mTOR signaling pathway mrv04210   Apoptosis mrv04218   Cellular senescence mrv04370   VEGF signaling pathway mrv04371   Apelin signaling pathway mrv04540   Gap junction mrv04625   C-type lectin receptor signaling pathway mrv04810   Regulation of actin cytoskeleton mrv04910   Insulin signaling pathway mrv04912   GnRH signaling pathway mrv04914   Progesterone-mediated oocyte maturation mrv04916   Melanogenesis Brite KEGG Orthology (KO) [BR:mrv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120388368    04012 ErbB signaling pathway     120388368    04370 VEGF signaling pathway     120388368    04371 Apelin signaling pathway     120388368    04068 FoxO signaling pathway     120388368    04150 mTOR signaling pathway     120388368  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120388368    04137 Mitophagy - animal     120388368   09143 Cell growth and death    04210 Apoptosis     120388368    04218 Cellular senescence     120388368   09144 Cellular community - eukaryotes    04540 Gap junction     120388368   09142 Cell motility    04810 Regulation of actin cytoskeleton     120388368  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120388368   09152 Endocrine system    04910 Insulin signaling pathway     120388368    04912 GnRH signaling pathway     120388368    04914 Progesterone-mediated oocyte maturation     120388368    04916 Melanogenesis     120388368  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mrv04131]     120388368   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mrv04031]     120388368 Membrane trafficking [BR:mrv04131]  Endocytosis   Macropinocytosis    Ras GTPases     120388368 GTP-binding proteins [BR:mrv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120388368 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  120388368 NCBI-ProteinID:  XP_039366101 LinkDB All DBs Position LG22:21786371..21799233 Genome browser AA seq 198 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDVHHYREQISRVKDSDDVPMVLVGNKCDL PSRTVDTKQAQELAKSYGIPFIETSAKTRQTHLTIPIKDQGPIGHLWVATYPSPPPGLRV KHKTSEVINQPPDQQEGL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggggctggcggcgtcggcaagagcgcgctcacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatagaggactcgtac cggaagcaggtggtgatcgacggcgagacgtgcctgctggacatcctggacacggccggg caggaggagtacagcgccatgcgcgaccagtacatgcgcacgggcgagggcttcctctgc gtcttcgccatcaacaacgcaaagtccttcgaggacgtgcaccactacagggagcagatc agcagggtgaaggactcggacgacgtccccatggtcttagtcggtaacaagtgcgacctg ccctctcggacggtggacaccaaacaggctcaggagctggcgaagagctacgggatccct ttcattgagacctcggccaaaaccaggcagacgcacttaacgattccaattaaggatcag ggccccattggtcatctgtgggtggctacgtacccatccccccctcctgggttaagggtc aagcacaaaacaagtgaggttatcaaccagcccccagatcagcaggaggggctatga

DBGET integrated database retrieval system