Mauremys reevesii (Reeves's turtle): 120403354 Help Entry 120403354         CDS       T07797                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mrv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120403354 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mrv04121]     120403354 (ELOB)    03400 DNA repair and recombination proteins [BR:mrv03400]     120403354 (ELOB) Ubiquitin system [BR:mrv04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      120403354 (ELOB)    Cul5 complex      120403354 (ELOB) DNA repair and recombination proteins [BR:mrv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120403354 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  120403354 NCBI-ProteinID:  XP_039390279 LinkDB All DBs Position LG4:149735964..149737570 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVYELKRIVEGILKRPPEEQRLYKDDQLLDDSKTLGDC GFTSQTARPQAPATVGLAFRAGDDSFEALRIDPFSSPPELPDVMKPQDSSSSANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctgatgatccggcgccacaagacaaccatcttcaccgacgccaaggag tccagcaccgtgtacgagctgaagcgcatcgtggagggcatcctcaagcggccccccgag gagcagcggctctacaaggatgaccagctgctagacgacagcaagaccctgggagactgc ggcttcaccagccagacagcgcggccccaggccccggccacagtgggcctggctttccga gccggggatgactccttcgaggctctccgcatcgaccccttctccagccccccagagctc cccgacgtcatgaaaccccaagactccagcagcagcgcgaacgaacaggccgtgcagtga

DBGET integrated database retrieval system