Mauremys reevesii (Reeves's turtle): 120404663 Help Entry 120404663         CDS       T07797                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04010   MAPK signaling pathway mrv04012   ErbB signaling pathway mrv04068   FoxO signaling pathway mrv04137   Mitophagy - animal mrv04140   Autophagy - animal mrv04150   mTOR signaling pathway mrv04210   Apoptosis mrv04218   Cellular senescence mrv04370   VEGF signaling pathway mrv04371   Apelin signaling pathway mrv04540   Gap junction mrv04625   C-type lectin receptor signaling pathway mrv04810   Regulation of actin cytoskeleton mrv04910   Insulin signaling pathway mrv04912   GnRH signaling pathway mrv04916   Melanogenesis Brite KEGG Orthology (KO) [BR:mrv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120404663 (NRAS)    04012 ErbB signaling pathway     120404663 (NRAS)    04370 VEGF signaling pathway     120404663 (NRAS)    04371 Apelin signaling pathway     120404663 (NRAS)    04068 FoxO signaling pathway     120404663 (NRAS)    04150 mTOR signaling pathway     120404663 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120404663 (NRAS)    04137 Mitophagy - animal     120404663 (NRAS)   09143 Cell growth and death    04210 Apoptosis     120404663 (NRAS)    04218 Cellular senescence     120404663 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     120404663 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120404663 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120404663 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120404663 (NRAS)    04912 GnRH signaling pathway     120404663 (NRAS)    04916 Melanogenesis     120404663 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mrv04131]     120404663 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mrv04147]     120404663 (NRAS)    04031 GTP-binding proteins [BR:mrv04031]     120404663 (NRAS) Membrane trafficking [BR:mrv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120404663 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120404663 (NRAS) Exosome [BR:mrv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120404663 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    120404663 (NRAS)   Exosomal proteins of breast cancer cells    120404663 (NRAS)   Exosomal proteins of colorectal cancer cells    120404663 (NRAS) GTP-binding proteins [BR:mrv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120404663 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  120404663 NCBI-ProteinID:  XP_039393471 LinkDB All DBs Position LG4:complement(139944355..139954819) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGFSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagctggtggcgttggcaaaagcgccctgacc attcagctcatccagaaccacttcgtggacgagtacgacccgaccatagaggattcatat cggaaacaggtagttattgatggtgagacctgtttgctagacattctggatactgcaggg caggaggagtacagtgctatgcgagaccagtacatgagaactggtgaaggcttcctctgt gtctttgccattaataacagcaaatcatttgctgatatcaatctctacagagagcagatt aagagagtgaaagattcagatgatgtgccaatggtgctagtgggaaacaagtgcgatttg cccacaaggacagtggatacaaaacaggctcaagaactagccaagagctatgggatcccc ttcattgagacgtcagccaaaacaagacagggtgtcgaagacgccttttacacattggtg agagagatccgccaataccgaatgaaaaagctcaacagcagtgaagatgggaatcaaggc tgcatgggattctcatgcattgtgatgtga

DBGET integrated database retrieval system