Mauremys reevesii (Reeves's turtle): 120404835 Help Entry 120404835         CDS       T07797                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04010   MAPK signaling pathway mrv04068   FoxO signaling pathway mrv04081   Hormone signaling mrv04114   Oocyte meiosis mrv04140   Autophagy - animal mrv04150   mTOR signaling pathway mrv04810   Regulation of actin cytoskeleton mrv04910   Insulin signaling pathway mrv04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:mrv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120404835 (INS)    04068 FoxO signaling pathway     120404835 (INS)    04150 mTOR signaling pathway     120404835 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     120404835 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120404835 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     120404835 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120404835 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     120404835 (INS)    04914 Progesterone-mediated oocyte maturation     120404835 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mrv04052]     120404835 (INS) Cytokines and neuropeptides [BR:mrv04052]  Neuropeptides   Unclassified    120404835 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin FNIP Ins_beta Motif Other DBs NCBI-GeneID:  120404835 NCBI-ProteinID:  XP_039393777 LinkDB All DBs Position LG4:107510664..107514886 Genome browser AA seq 106 aa AA seqDB search MALWIRSLPLLALLALSGPPISHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDLEQ PLVNGHLPNSVEELSFQQEYQQDKRGIVEQCCHNTCSLYQLENYCN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctctcctggcccttcttgccctttctggcccccct atcagccatgctgctgccaaccagcacctctgtggctcacacctagtggaggccctctat ctggtgtgtggagaacggggcttcttctactctcccaaagcccgacgggacctcgagcag cccctagtgaatggccatctgccgaattcggtggaagaactgtcattccaacaggaatac cagcaagacaagaggggaatcgttgagcaatgctgccataacacctgctccctgtaccag ctggaaaactactgcaattag

DBGET integrated database retrieval system