Mauremys reevesii (Reeves's turtle): 120405072 Help Entry 120405072         CDS       T07797                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04010   MAPK signaling pathway mrv04012   ErbB signaling pathway mrv04068   FoxO signaling pathway mrv04137   Mitophagy - animal mrv04140   Autophagy - animal mrv04144   Endocytosis mrv04150   mTOR signaling pathway mrv04210   Apoptosis mrv04218   Cellular senescence mrv04370   VEGF signaling pathway mrv04371   Apelin signaling pathway mrv04510   Focal adhesion mrv04519   Cadherin signaling mrv04540   Gap junction mrv04625   C-type lectin receptor signaling pathway mrv04810   Regulation of actin cytoskeleton mrv04910   Insulin signaling pathway mrv04912   GnRH signaling pathway mrv04916   Melanogenesis mrv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mrv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120405072 (HRAS)    04012 ErbB signaling pathway     120405072 (HRAS)    04370 VEGF signaling pathway     120405072 (HRAS)    04371 Apelin signaling pathway     120405072 (HRAS)    04068 FoxO signaling pathway     120405072 (HRAS)    04150 mTOR signaling pathway     120405072 (HRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     120405072 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120405072 (HRAS)    04140 Autophagy - animal     120405072 (HRAS)    04137 Mitophagy - animal     120405072 (HRAS)   09143 Cell growth and death    04210 Apoptosis     120405072 (HRAS)    04218 Cellular senescence     120405072 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120405072 (HRAS)    04540 Gap junction     120405072 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120405072 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120405072 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120405072 (HRAS)    04912 GnRH signaling pathway     120405072 (HRAS)    04916 Melanogenesis     120405072 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120405072 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mrv04131]     120405072 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mrv04147]     120405072 (HRAS)    04031 GTP-binding proteins [BR:mrv04031]     120405072 (HRAS) Membrane trafficking [BR:mrv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120405072 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120405072 (HRAS) Exosome [BR:mrv04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120405072 (HRAS)   Exosomal proteins of colorectal cancer cells    120405072 (HRAS) GTP-binding proteins [BR:mrv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120405072 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  120405072 NCBI-ProteinID:  XP_039394229 LinkDB All DBs Position LG4 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARNYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggtggtggttggagcaggtggcgttgggaagagcgctttgaca atacagctcattcagaaccattttgttgatgaatatgaccccacgatagaggattcctac agaaagcaggtagtcattgacggagagacctgtctgttagacatcttggacacggcgggt caagaggagtacagcgccatgcgagaccaatacatgcggacgggagaaggcttcctgtgc gtctttgccattaacaatacgaaatcctttgaagatattcaccagtaccgagagcagatc aagagagtgaaggattcagacgatgtccccatggtgctggtgggaaacaagtgtgacctt ccagcccggacagtggaaacccggcaagcacaggacctggccaggaattacgggatcccc tacatagagacgtcagcgaaaaccagacagggtgttgaagacgccttctataccttagtg cgggagatccggcagcacaaactacgcaagctgaatccaccggatgaaagtggcccaggc tgcatgaattgtaaatgtgtgatatcatga

DBGET integrated database retrieval system