Mauremys reevesii (Reeves's turtle): 120406412 Help Entry 120406412         CDS       T07797                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04060   Cytokine-cytokine receptor interaction mrv04218   Cellular senescence mrv04620   Toll-like receptor signaling pathway mrv04621   NOD-like receptor signaling pathway mrv04622   RIG-I-like receptor signaling pathway mrv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mrv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120406412  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120406412  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120406412    04621 NOD-like receptor signaling pathway     120406412    04622 RIG-I-like receptor signaling pathway     120406412  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120406412  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mrv04052]     120406412    00536 Glycosaminoglycan binding proteins [BR:mrv00536]     120406412 Cytokines and neuropeptides [BR:mrv04052]  Cytokines   Chemokines    120406412 Glycosaminoglycan binding proteins [BR:mrv00536]  Heparan sulfate / Heparin   Chemokines    120406412 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120406412 NCBI-ProteinID:  XP_039397195 LinkDB All DBs Position LG5:11827366..11830601 Genome browser AA seq 104 aa AA seqDB search MNGKLVAAVLALFLTYAAVSEGMSLARMGNELRCQCIDLHSKFIPPRNIRDVKLTPSGPH CQNTEIIATLKDGREVCLDPTAQWVKRIIKAILDKDQANAEAKR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaagttggttgctgctgtcttggctcttttcctaacctacgcagcggtgtca gaagggatgagtctggcaaggatggggaatgagctccgatgccagtgcatcgacctgcat tccaagttcatccctcccaggaacattcgggatgtgaagctgaccccaagcggacctcac tgccagaacactgaaatcatcgctactctcaaggacggcagagaagtgtgcttggatccc actgctcaatgggtgaagagaatcattaaagcaattttggacaaagatcaagccaatgct gaggcaaaacgctaa

DBGET integrated database retrieval system