Mauremys reevesii (Reeves's turtle): 120406447 Help Entry 120406447         CDS       T07797                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04060   Cytokine-cytokine receptor interaction mrv04218   Cellular senescence mrv04620   Toll-like receptor signaling pathway mrv04621   NOD-like receptor signaling pathway mrv04622   RIG-I-like receptor signaling pathway mrv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mrv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120406447  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120406447  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120406447    04621 NOD-like receptor signaling pathway     120406447    04622 RIG-I-like receptor signaling pathway     120406447  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120406447  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mrv04052]     120406447    00536 Glycosaminoglycan binding proteins [BR:mrv00536]     120406447 Cytokines and neuropeptides [BR:mrv04052]  Cytokines   Chemokines    120406447 Glycosaminoglycan binding proteins [BR:mrv00536]  Heparan sulfate / Heparin   Chemokines    120406447 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120406447 NCBI-ProteinID:  XP_039397276 LinkDB All DBs Position LG5:complement(12338131..12340829) Genome browser AA seq 104 aa AA seqDB search MNGKLVAAVLALFLTYAAVSEGMSLARMGNELRCQCIDLHSKFIPPRSIRNAKLTPSGPH CENTEIIATLKDGREVCLDPTAQWVKIIIKAILDKDQANAEAKR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaagttggttgctgctgtcttggctcttttcctaacctacgcagcggtgtca gaagggatgagtctggcaaggatggggaatgagctccgatgccagtgcatcgacctgcat tccaagttcatccctcccaggagcattcggaatgcgaagctgaccccaagcggacctcac tgcgagaacactgaaatcatcgctactctcaaggacggcagagaagtgtgcttggatccc actgctcaatgggtgaagatcatcattaaagcaattttggacaaagatcaagccaatgct gaggcaaaacgctaa

DBGET integrated database retrieval system