Marinobacter sp. RI1: MspRI1_09890 Help Entry MspRI1_09890      CDS       T10737                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism mrx  Marinobacter sp. RI1 Brite KEGG Orthology (KO) [BR:mrx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mrx03036]     MspRI1_09890 Chromosome and associated proteins [BR:mrx03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MspRI1_09890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SPAM ZapB Filament Taxilin ATS TrbK RecG_N MRB1590_C bpMoxR TSC22 YabA TMF_DNA_bd FapA TraF_2 Motif Other DBs NCBI-ProteinID:  BFN12978 LinkDB All DBs Position complement(1138602..1138871) Genome browser AA seq 89 aa AA seqDB search MTGLARALIVTLIKITDVGQVMEQSEVQALADKLDKLIERCDKLEKDNALLRELQDDWNR ERAQLMHKNDLAKNKIEAMIGRLRALEHH NT seq 270 nt NT seq  +upstreamnt  +downstreamnt ttgaccggtctggcgcgcgcacttatagtaactctcatcaaaatcaccgatgttgggcag gtcatggaacagtccgaagtacaggcattagcggacaagctggacaagctgatcgagcgc tgcgacaagctggagaaagacaacgccctgctaagggagctgcaggacgactggaaccgg gaacgggcccagctaatgcacaaaaacgatcttgccaaaaacaagattgaagccatgatc ggccgtcttcgggcactggagcaccactga

DBGET integrated database retrieval system