Marinobacter sp. RI1: MspRI1_26450 Help Entry MspRI1_26450      CDS       T10737                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mrx  Marinobacter sp. RI1 Pathway mrx01100   Metabolic pathways mrx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mrx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MspRI1_26450 (acpP)    00074 Mycolic acid biosynthesis     MspRI1_26450 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MspRI1_26450 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  BFN14634 LinkDB All DBs Position complement(2938730..2938963) Genome browser AA seq 77 aa AA seqDB search MSTVEERVKKIVCEQLGVKESEVQNTSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKLGTVQDAIDYIVAHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtacagttgaagagcgcgttaagaagattgtttgtgagcagttgggcgtgaaagag tccgaagttcagaacacatcttcttttgtagaggatcttggcgctgactcactggacact gttgagctggttatggccctggaagaggaattcgagaccgagattcctgacgaagaggcc gaaaagctgggcaccgttcaggacgcgatcgactacattgtcgcgcacacctga

DBGET integrated database retrieval system