Mycobacterium sp. JS623: Mycsm_01449 Help Entry Mycsm_01449       CDS       T02423                                  Name (GenBank) Glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism msa  Mycobacterium sp. JS623 Brite KEGG Orthology (KO) [BR:msa00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Mycsm_01449 Enzymes [BR:msa01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Mycsm_01449 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Thioredoxin Glrx-like GST_N_3 GST_N Motif Other DBs NCBI-ProteinID:  AGB21860 UniProt:  L0IQS8 LinkDB All DBs Position complement(1448778..1449026) Genome browser AA seq 82 aa AA seqDB search MSALTMYSTSWCGYCFRLKKILKAEGISFAEVDIEADPAAAQFVASVNGGNQTVPTLKFA DGSTLTNPSGAEVKAKLAKLAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagcgctttgaccatgtacagcacctcatggtgtggctactgcttccgcctgaaaaag attttgaaggcggagggcatttcgttcgccgaggtcgatatcgaagccgatcccgccgcg gcgcagtttgtggcatcggtcaatggcggcaatcagacggtgccgacgctgaagttcgcg gatggctcgacgctgaccaacccaagcggcgcagaggtcaaagccaagctggcgaagcta gccagttag

DBGET integrated database retrieval system