Mycobacterium sp. JS623: Mycsm_04375 Help Entry Mycsm_04375       CDS       T02423                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism msa  Mycobacterium sp. JS623 Pathway msa01100   Metabolic pathways msa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mycsm_04375    00074 Mycolic acid biosynthesis     Mycsm_04375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mycsm_04375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 MAD7 Motif Other DBs NCBI-ProteinID:  AGB24619 LinkDB All DBs Position 4312330..4312593 Genome browser AA seq 87 aa AA seqDB search MSPKNSAVALEAVTQEIIDLVAAEVGAVDVTAEAALQSWGLDSLKVMSLVFKIEERYGII LDEQDADDLRTVGDLAALALRRIQERP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcgccgaaaaactctgccgtagcgcttgaggccgtgacgcaggagatcatcgacctc gtcgccgcggaagtgggagctgtggatgtcaccgccgaagcggctctacagagctggggc ctggattcgctcaaagtcatgtcactcgtgttcaagatcgaggagcgttacggcatcatc ctcgatgagcaggacgcagacgatctgcgcaccgttggcgatctagcagcattagcgctc cgccgcattcaggagcgaccgtga

DBGET integrated database retrieval system