Mycobacteroides salmoniphilum: DSM43276_03337 Help Entry DSM43276_03337    CDS       T06041                                  Name (GenBank) Putative glutaredoxin.1   KO K18917   mycoredoxin [EC:1.20.4.3] Organism msal  Mycobacteroides salmoniphilum Brite KEGG Orthology (KO) [BR:msal00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     DSM43276_03337 Enzymes [BR:msal01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      DSM43276_03337 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin GST_N_2 Thioredoxin_2 Glrx-like GST_N_3 Motif Other DBs NCBI-ProteinID:  QCH25063 LinkDB All DBs Position 3358410..3358682 Genome browser AA seq 90 aa AA seqDB search MTLNADVTTASDSSLIMYSTTWCGYCRRLETQLKAAGIDYTKVDIEQDPAAADYVANVNG GNQTVPTVKFPDGSALTNPSLAQVKAKLGV NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacgttgaatgccgatgtgactacagcgagcgactccagtctcatcatgtacagcacc acctggtgcggctattgccgtcgactcgagacgcagctcaaggccgcgggcatcgattac accaaggtggacatcgaacaggacccggccgcggccgactacgtcgcgaacgtcaacggc ggaaaccagaccgtgccgaccgtgaagttccctgacggcagcgcgctgaccaatccgtcg ctggcacaggtcaaggccaagctcggggtctag

DBGET integrated database retrieval system