KEGG   Mycobacteroides salmoniphilum: DSM43276_03388
Entry
DSM43276_03388    CDS       T06041                                 
Symbol
mtrA
Name
(GenBank) DNA-binding response regulator MtrA
  KO
K07670  two-component system, OmpR family, response regulator MtrA
Organism
msal  Mycobacteroides salmoniphilum
Pathway
msal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSM43276_03388 (mtrA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:msal02022]
    DSM43276_03388 (mtrA)
Two-component system [BR:msal02022]
 OmpR family
  MtrB-MtrA (osmotic stress response)
   DSM43276_03388 (mtrA)
SSDB
Motif
Pfam: Response_reg Trans_reg_C GlnR_1st FleQ
Other DBs
NCBI-ProteinID: QCH25114
LinkDB
Position
complement(3413510..3414187)
AA seq 225 aa
MRQRILVVDDDASLAEMLTIVLRGEGFETAVVSDGTQALTAVRELRPDLVLLDLMLPGMN
GIDVCRVLRSDSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARIRARLRRN
DDEPAEMLNIAGIEIDVPAHKVTREGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVW
GYRHPADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaggcaaaggatccttgttgtcgacgatgacgcgtcattggcagagatgctcaccatc
gtgttgcgcggggagggcttcgagacggcagtggtgagcgacggtacccaggcgctcacc
gccgttcgcgagctgcgccctgatctggttctgttggacctcatgctgcccggcatgaat
ggcattgacgtatgccgggtgctgcgttccgattccggtgttccgatcgtcatgctcacc
gccaagaccgacaccgttgacgtggtgctcggtctggagtccggcgccgacgactacatc
atgaagcccttcaaacccaaggaactggtcgcccgcatccgtgcccggttgcggcgtaac
gacgatgagccggccgagatgctgaacatcgcgggtatcgagatcgatgtgcccgcgcac
aaggtgacgcgcgagggcgagcagatctccctgacgccgctggagttcgaccttctggtg
gcgctggcacgtaaaccgcgccaggtgtttactcgtgatgtgctgctcgaacaggtgtgg
ggttaccgtcacccggccgatacccggctggtgaacgtccacgtgcagcggctgcgggcg
aaggtcgagaaggacccggagaatccgaccgtggtgttgaccgttcgaggagtgggatat
aaggccggacccccgtga

DBGET integrated database retrieval system