Micropterus salmoides (largemouth bass): 119882793 Help Entry 119882793         CDS       T07309                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04814   Motor proteins msam05132   Salmonella infection Brite KEGG Orthology (KO) [BR:msam00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     119882793 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119882793 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:msam03037]     119882793 (dynll2a)    04812 Cytoskeleton proteins [BR:msam04812]     119882793 (dynll2a) Cilium and associated proteins [BR:msam03037]  Motile cilia and associated proteins   Dynein arm    119882793 (dynll2a) Cytoskeleton proteins [BR:msam04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      119882793 (dynll2a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  119882793 NCBI-ProteinID:  XP_038548974 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaagctgtgatcaagaacgcggacatgtccgaggacatgcagcaagac gcggtggactgtgccacccaggccatggagaagtacaacatagagaaggacatcgcagcc tacatcaagaaggaatttgataagaagtataaccccacctggcactgcatcgtcgggagg aacttcggcagctacgtcacccacgagacaaagcatttcatttacttctacttgggccaa gtggccatattgctcttcaagtctggctga

DBGET integrated database retrieval system