Micropterus salmoides (largemouth bass): 119885827 Help Entry 119885827         CDS       T07309                                  Name (RefSeq) 14-3-3 protein beta/alpha-1-like   KO K16197   14-3-3 protein beta/theta/zeta Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04110   Cell cycle msam04114   Oocyte meiosis Brite KEGG Orthology (KO) [BR:msam00001]  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     119885827    04114 Oocyte meiosis     119885827  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:msam03400]     119885827   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msam04147]     119885827 DNA repair and recombination proteins [BR:msam03400]  Eukaryotic type   Check point factors    Other check point factors     119885827 Exosome [BR:msam04147]  Exosomal proteins   Proteins found in most exosomes    119885827 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  14-3-3 Motif Other DBs NCBI-GeneID:  119885827 NCBI-ProteinID:  XP_038552010 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search TLLVACLFQNLLDKFLIPNASQAESKVFYLKMKGDYFRYLSEVASGDSKKDTVENSQQAY QQAFDISKKDMQPTHPIWLGLALNFSVFYYEILNSPEQACALAKQAFDEAIAELDTLNED SYKDSTLIMQL NT seq 393 nt NT seq  +upstreamnt  +downstreamnt acccttctggtcgcctgtctgtttcagaatctgctcgacaaattcctcattcccaatgca tctcaggcggagagcaaggtgttctacctcaaaatgaaaggagactacttcagatacctg tcggaggtggcttctggggactcaaagaaggacacggtggagaactctcagcaggcctac cagcaagccttcgacatcagcaagaaggacatgcagccaacgcaccctatctggctgggc ttggccctcaacttctccgtcttctactatgaaatcctcaactcgcccgagcaggcctgc gctctggccaagcaggctttcgatgaggcaatcgccgagctcgacaccttgaacgaggac tcctacaaagacagcacgctgatcatgcagcta

DBGET integrated database retrieval system