Micropterus salmoides (largemouth bass): 119886341 Help Entry 119886341         CDS       T07309                                  Symbol myl2a Name (RefSeq) myosin regulatory light chain 2a   KO K10351   myosin regulatory light chain 2 Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04260   Cardiac muscle contraction msam04261   Adrenergic signaling in cardiomyocytes msam04371   Apelin signaling pathway msam04510   Focal adhesion msam04520   Adherens junction msam04530   Tight junction msam04810   Regulation of actin cytoskeleton msam04814   Motor proteins msam04820   Cytoskeleton in muscle cells msam05132   Salmonella infection Brite KEGG Orthology (KO) [BR:msam00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     119886341 (myl2a)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     119886341 (myl2a)    04520 Adherens junction     119886341 (myl2a)    04530 Tight junction     119886341 (myl2a)   09142 Cell motility    04814 Motor proteins     119886341 (myl2a)    04820 Cytoskeleton in muscle cells     119886341 (myl2a)    04810 Regulation of actin cytoskeleton     119886341 (myl2a)  09150 Organismal Systems   09153 Circulatory system    04260 Cardiac muscle contraction     119886341 (myl2a)    04261 Adrenergic signaling in cardiomyocytes     119886341 (myl2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119886341 (myl2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:msam04812]     119886341 (myl2a) Cytoskeleton proteins [BR:msam04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      119886341 (myl2a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DUF2267 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  119886341 NCBI-ProteinID:  XP_038552928 LinkDB All DBs Position Unknown AA seq 169 aa AA seqDB search MAPKKAKKRSAEGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRL NVKQEEIDEMLKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLRKDYV TQMLTTQADRFSPEEMEQMFAAFPPDVAGNLDYKNLVHIITHGEEKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcccccaagaaagccaagaagaggtcagcagagggagccaactccaacgtgttctcc atgtttgagcaggctcagattcaggaatttaaagaggctttcaccattatggaccagaac agagatggctttatcgacaagaatgatctgagggacacttttgctgctctaggacgcctc aacgtgaaacaggaagagatcgatgagatgctcaaagaggctcctggcccaatcaacttt accgtcttcctcaccatgttcggtgagaagctgaaaggtgctgatccagaggagaccatc ctcaacgcgtttaaagtctttgaccctgaggggaaaggtgtactcaggaaggactatgtg acacagatgctaacaacacaagcggaccgtttctcccctgaagagatggagcagatgttc gctgccttccccccagatgtggcagggaatctggactacaagaacctggttcacataatt acccatggagaggaaaaggaccaggagtag

DBGET integrated database retrieval system