Micropterus salmoides (largemouth bass): 119886647 Help Entry 119886647         CDS       T07309                                  Name (RefSeq) zgc:55558   KO K07827   GTPase KRas Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04010   MAPK signaling pathway msam04012   ErbB signaling pathway msam04068   FoxO signaling pathway msam04137   Mitophagy - animal msam04140   Autophagy - animal msam04150   mTOR signaling pathway msam04210   Apoptosis msam04218   Cellular senescence msam04370   VEGF signaling pathway msam04371   Apelin signaling pathway msam04540   Gap junction msam04625   C-type lectin receptor signaling pathway msam04810   Regulation of actin cytoskeleton msam04910   Insulin signaling pathway msam04912   GnRH signaling pathway msam04914   Progesterone-mediated oocyte maturation msam04916   Melanogenesis Brite KEGG Orthology (KO) [BR:msam00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119886647    04012 ErbB signaling pathway     119886647    04370 VEGF signaling pathway     119886647    04371 Apelin signaling pathway     119886647    04068 FoxO signaling pathway     119886647    04150 mTOR signaling pathway     119886647  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119886647    04137 Mitophagy - animal     119886647   09143 Cell growth and death    04210 Apoptosis     119886647    04218 Cellular senescence     119886647   09144 Cellular community - eukaryotes    04540 Gap junction     119886647   09142 Cell motility    04810 Regulation of actin cytoskeleton     119886647  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119886647   09152 Endocrine system    04910 Insulin signaling pathway     119886647    04912 GnRH signaling pathway     119886647    04914 Progesterone-mediated oocyte maturation     119886647    04916 Melanogenesis     119886647  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msam04131]     119886647   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:msam04031]     119886647 Membrane trafficking [BR:msam04131]  Endocytosis   Macropinocytosis    Ras GTPases     119886647 GTP-binding proteins [BR:msam04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     119886647 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N SatRNA_48 Septin Sua5_yciO_yrdC Motif Other DBs NCBI-GeneID:  119886647 NCBI-ProteinID:  XP_038553459 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL GTRTVETRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKNT QRRCIIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaacttgtggtggtcggggcaggaggtgtggggaagagcgcgctcacc atccagctcatccagaaccacttcgttgatgagtatgatccaaccatcgaggactcgtac agaaaacaggtggtgattgatggagagacgtgtctgttggacatcctggacacggcaggt caggaggagtacagcgccatgcgggatcagtacatgaggacaggggagggcttcctctgt gtgtttgccatcaacaacatcaagtccttcgaggacgttcacctctacagagagcagatc aacagggtgaaggacagtgacagcgtccccatggtgctggtggggaacaagagcgacctg ggtacccgcacggtggagacgcggcaggcgcaggagcttgcacgaagctatggggtgccg tttgtcgagacctctgccaaaaccagacagggcgtggaggaggctttctattcactagtg cgggagattagaagatataaagagaccaaccgtagcaacaagaagagcaagaagaacact cagagacgttgcataatactatag

DBGET integrated database retrieval system