Micropterus salmoides (largemouth bass): 119890203 Help Entry 119890203         CDS       T07309                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism msam  Micropterus salmoides (largemouth bass) Pathway msam03030   DNA replication msam03082   ATP-dependent chromatin remodeling msam03410   Base excision repair msam03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:msam00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     119890203 (pole3)    03410 Base excision repair     119890203 (pole3)    03420 Nucleotide excision repair     119890203 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     119890203 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:msam03032]     119890203 (pole3)    03036 Chromosome and associated proteins [BR:msam03036]     119890203 (pole3)    03400 DNA repair and recombination proteins [BR:msam03400]     119890203 (pole3) Enzymes [BR:msam01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      119890203 (pole3) DNA replication proteins [BR:msam03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     119890203 (pole3) Chromosome and associated proteins [BR:msam03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     119890203 (pole3) DNA repair and recombination proteins [BR:msam03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       119890203 (pole3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP SpoU_methylase DUF5427 RNA_pol_3_Rpc31 DUF3276 DUF4746 CDC45 Motif Other DBs NCBI-GeneID:  119890203 NCBI-ProteinID:  XP_038557275 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLAAMEEMEFERFLEPLREALDVYKKGQKGKKEVSEQKRKDKEKKADSENDK SREEEEEEEERMEEEPEAENEAEEEEVEN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagagaggccagaagatctgaaccttcccaacgcggtgatcacccgcatcatcaag gaggcgctcccagacggggtgaacgtgtcgaaagaagcgaggagagccatatcccaagct gccagtgtgtttgtgttgtacgcaacgtcctgtgcaaacaacttcgccatgaaagctaag cggaaaactctgaatgcaggagacgtcttggctgcgatggaggaaatggagtttgagcga ttcctcgagcctctcagagaagctttggacgtgtataagaagggccagaaaggaaagaag gaggtgtctgagcagaagcgcaaagataaagagaagaaggccgactctgagaacgataag agccgggaggaagaggaggaggaagaggagcgcatggaggaggagcctgaagctgagaac gaagcagaggaggaggaggtggagaactga

DBGET integrated database retrieval system