Micropterus salmoides (largemouth bass): 119890700
Help
Entry
119890700 CDS
T07309
Name
(RefSeq) cytochrome b-c1 complex subunit Rieske, mitochondrial
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
msam
Micropterus salmoides (largemouth bass)
Pathway
msam00190
Oxidative phosphorylation
msam01100
Metabolic pathways
msam04148
Efferocytosis
msam04260
Cardiac muscle contraction
Module
msam_M00151
Cytochrome bc1 complex respiratory unit
msam_M00152
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:
msam00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
119890700
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
119890700
09150 Organismal Systems
09153 Circulatory system
04260 Cardiac muscle contraction
119890700
Enzymes [BR:
msam01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
119890700
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Ubiq-Cytc-red_N
UCR_TM
Rieske
UCR_Fe-S_N
Motif
Other DBs
NCBI-GeneID:
119890700
NCBI-ProteinID:
XP_038558010
LinkDB
All DBs
Position
Unknown
AA seq
273 aa
AA seq
DB search
MMSLAARSGAFSPYMQATAFAVAGPLKALVPGVVVKGEKILLNPKKQFLCRESLNGQSPK
TGPAVTVSINGCAGVRFAHTDVRVPDFSDYRRPDVVDPNKSSQESSESRRVFSYLVTGAS
TVVGVYAAKTVVSQFVSSMSASADVLALSKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTE
KEIATEANVNMGELRDPQHDKDRVINPSWVIVLGVCTHLGCVPIANAGDFGGYYCPCHGS
HYDASGRIRKGPAPLNLEVPYYEFADEDTVIVG
NT seq
822 nt
NT seq
+upstream
nt +downstream
nt
atgatgtcccttgctgcccggtcaggggcattttccccttacatgcaggctacggctttt
gcggttgctggtcccctgaaagctctggtacctggtgttgttgtaaagggagagaagatt
ttgttaaacccgaaaaaacagttcctgtgccgcgaatcgctgaacggtcaaagcccaaag
acagggcctgctgtgacggttagcatcaatggctgtgcaggagtccgatttgcccacaca
gacgtcagggtaccagacttctccgactacaggcgcccggacgtggtcgaccccaacaag
tcctcccaggaaagcagtgaatcacgaagagtcttctcgtacctggtcaccggggcctca
accgtggtgggcgtctatgccgccaagacggtggtctctcagtttgtttcttccatgagc
gcctcggccgacgtcctggccctgtccaagatcgaaatcaagctgagcgacatccccgaa
ggcaaaaacatgaccttcaagtggagaggcaaaccgctgttcgtccgccaccgcacagag
aaggagatcgccacagaggccaacgtgaacatgggagagctgcgcgaccctcagcacgac
aaggaccgggtcatcaatcccagctgggtcatcgtccttggggtgtgcacgcatctgggc
tgcgtgcccattgccaacgctggcgactttggaggttactactgcccctgccacggctca
cattacgacgcctcaggccgcatcaggaaaggccccgcccccctcaacctggaggttccc
tactatgagtttgcagacgaagacaccgtgattgttggataa
DBGET
integrated database retrieval system