Micropterus salmoides (largemouth bass): 119893575 Help Entry 119893575         CDS       T07309                                  Symbol hrasb Name (RefSeq) HRas proto-oncogene, GTPase b   KO K02833   GTPase HRas Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04010   MAPK signaling pathway msam04012   ErbB signaling pathway msam04068   FoxO signaling pathway msam04137   Mitophagy - animal msam04140   Autophagy - animal msam04144   Endocytosis msam04150   mTOR signaling pathway msam04210   Apoptosis msam04218   Cellular senescence msam04370   VEGF signaling pathway msam04371   Apelin signaling pathway msam04510   Focal adhesion msam04540   Gap junction msam04625   C-type lectin receptor signaling pathway msam04810   Regulation of actin cytoskeleton msam04910   Insulin signaling pathway msam04912   GnRH signaling pathway msam04916   Melanogenesis msam05132   Salmonella infection Brite KEGG Orthology (KO) [BR:msam00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119893575 (hrasb)    04012 ErbB signaling pathway     119893575 (hrasb)    04370 VEGF signaling pathway     119893575 (hrasb)    04371 Apelin signaling pathway     119893575 (hrasb)    04068 FoxO signaling pathway     119893575 (hrasb)    04150 mTOR signaling pathway     119893575 (hrasb)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     119893575 (hrasb)    04140 Autophagy - animal     119893575 (hrasb)    04137 Mitophagy - animal     119893575 (hrasb)   09143 Cell growth and death    04210 Apoptosis     119893575 (hrasb)    04218 Cellular senescence     119893575 (hrasb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     119893575 (hrasb)    04540 Gap junction     119893575 (hrasb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     119893575 (hrasb)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119893575 (hrasb)   09152 Endocrine system    04910 Insulin signaling pathway     119893575 (hrasb)    04912 GnRH signaling pathway     119893575 (hrasb)    04916 Melanogenesis     119893575 (hrasb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119893575 (hrasb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msam04131]     119893575 (hrasb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msam04147]     119893575 (hrasb)    04031 GTP-binding proteins [BR:msam04031]     119893575 (hrasb) Membrane trafficking [BR:msam04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     119893575 (hrasb)  Endocytosis   Macropinocytosis    Ras GTPases     119893575 (hrasb) Exosome [BR:msam04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    119893575 (hrasb)   Exosomal proteins of colorectal cancer cells    119893575 (hrasb) GTP-binding proteins [BR:msam04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     119893575 (hrasb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  119893575 NCBI-ProteinID:  XP_038561748 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatagaggactcgtac aggaaacaggttgtgattgacggggagacctgcctgctggacatcctggacactgcaggt caggaggagtacagcgctatgagggatcagtacatgaggacaggggagggcttcctctgt gtctttgccatcaacaacaccaagtcttttgaggacattcatcagtacagagaacagatt aaacgtgtaaaggactcagacgatgttcccatggtgcttgtgggaaacaaatgtgacctc ccggcacgcacagtggacacaaggcaagcccaggaactcgcccgctcctacggcatccct tacattgagacctctgccaagacacgacagggagtagaggacgctttctacacactggtt agggagatcagacagcataagctgaggaagctgaacccgcctgatgagagcggtcaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system