Micropterus salmoides (largemouth bass): 119895802 Help Entry 119895802         CDS       T07309                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04145   Phagocytosis msam04517   IgSF CAM signaling msam04814   Motor proteins msam05132   Salmonella infection Brite KEGG Orthology (KO) [BR:msam00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     119895802 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     119895802 (dynll2b)   09142 Cell motility    04814 Motor proteins     119895802 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119895802 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:msam03037]     119895802 (dynll2b)    04812 Cytoskeleton proteins [BR:msam04812]     119895802 (dynll2b) Cilium and associated proteins [BR:msam03037]  Motile cilia and associated proteins   Dynein arm    119895802 (dynll2b) Cytoskeleton proteins [BR:msam04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      119895802 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Motif Other DBs NCBI-GeneID:  119895802 NCBI-ProteinID:  XP_038565061 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MSDKKAVIKNADMSDDMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagaaggcagtgataaagaatgctgacatgtctgatgacatgcagcaggat gcagtggactgtgccatgcaggctatggagaagtacaacattgagaaggatattgccgcc tatgtcaaaaaagagtttgacaagaagtacaaccccacgtggcattgcattgttgggagg aactttggcagctacgtgacgcatgagacgaagcatttcatctacttctacctgggccag gtggccattctacttttcaagtccggctga

DBGET integrated database retrieval system