Micropterus salmoides (largemouth bass): 119897425 Help Entry 119897425         CDS       T07309                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04010   MAPK signaling pathway msam04144   Endocytosis msam04370   VEGF signaling pathway msam04510   Focal adhesion msam04520   Adherens junction msam04530   Tight junction msam04810   Regulation of actin cytoskeleton msam04912   GnRH signaling pathway msam05100   Bacterial invasion of epithelial cells msam05132   Salmonella infection Brite KEGG Orthology (KO) [BR:msam00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119897425 (cdc42l)    04370 VEGF signaling pathway     119897425 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     119897425 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     119897425 (cdc42l)    04520 Adherens junction     119897425 (cdc42l)    04530 Tight junction     119897425 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     119897425 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     119897425 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119897425 (cdc42l)    05100 Bacterial invasion of epithelial cells     119897425 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msam04131]     119897425 (cdc42l)    03036 Chromosome and associated proteins [BR:msam03036]     119897425 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msam04147]     119897425 (cdc42l)    04031 GTP-binding proteins [BR:msam04031]     119897425 (cdc42l) Membrane trafficking [BR:msam04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119897425 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     119897425 (cdc42l)   Macropinocytosis    Ras GTPases     119897425 (cdc42l) Chromosome and associated proteins [BR:msam03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     119897425 (cdc42l) Exosome [BR:msam04147]  Exosomal proteins   Exosomal proteins of microglial cells    119897425 (cdc42l)   Exosomal proteins of breast milk    119897425 (cdc42l) GTP-binding proteins [BR:msam04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119897425 (cdc42l) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  119897425 NCBI-ProteinID:  XP_038567045 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQMDLR EDSNTVEKLAKNKQRPLYPESGEKLARELKAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagtggtaggggacggtgcagtaggaaagacctgcttactg atctcctacacaaccaacaagttcccctcagaatatgtgcctacggtttttgacaattat gcagtgactgtgatgattgggggagagccctatacgcttggcctgtttgacacagcaggt caggaggattatgacaggctgcgtcctctcagctatccacagacagatgtgttcctcgta tgtttctctgttgtctccccctcatcatttgaaaatgtcaaagagaagtgggttcctgag atttctcaccactgcccacgcacacctttcctgttagtgggtacacagatggatctgcgg gaagatagcaacacggtcgagaagctggcaaagaacaagcagcgccccctatatcctgag agtggagagaagctggctcgtgagctgaaagctgtcaaatacgtggagtgctctgctctg acacagcgagggcttaaaaacgtgtttgacgaggccatcctggcagccttggagcctcct gagaccaaaaccaagagaaagtgtgtcctgctatag

DBGET integrated database retrieval system