KEGG   Micropterus salmoides (largemouth bass): 119899190
Entry
119899190         CDS       T07309                                 
Symbol
cdkn2d
Name
(RefSeq) cyclin-dependent kinase 4 inhibitor D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
msam  Micropterus salmoides (largemouth bass)
Pathway
msam04068  FoxO signaling pathway
msam04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:msam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    119899190 (cdkn2d)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    119899190 (cdkn2d)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 Nitrophorin
Other DBs
NCBI-GeneID: 119899190
NCBI-ProteinID: XP_038569590
LinkDB
Position
Unknown
AA seq 164 aa
MVLSQMDAGKALTAAAAKGNTSEVLRILEECRVHPDTLNEFGRTALQVMMMGNSKIASLL
LEKGADPNVQDKHGIAPIHDAARTGFLDTVQVLVEYGALVNIPDQSGALPIHIAIREGHR
DVVEFLAPRSDLKHANVSGQTAIDVARASRLPDMIDLLFAHIHS
NT seq 495 nt   +upstreamnt  +downstreamnt
atggtccttagtcagatggatgccggtaaagctttgacggcggcagcagccaaaggaaat
acaagcgaggtgctgaggatcctggaggaatgcagagtgcatcctgatactctcaatgaa
tttggcaggactgcgctacaggtgatgatgatggggaactccaagatcgccagtttgctg
ttggaaaaaggagcagatcccaacgtgcaggacaaacacgggatagcgcccatccatgat
gcagcccggacaggattcctggacactgtgcaggttctggtggagtacggcgctttggta
aacatcccggaccagagtggtgccctgcctatccacatcgccatccgagaaggccaccgt
gatgtcgtggagttcttggcgccacggtctgacctgaagcatgccaacgtcagcggtcag
acagcgatagacgtggcccgagcttcacgtttgcccgatatgattgacttgctttttgct
cacattcatagttag

DBGET integrated database retrieval system