Micropterus salmoides (largemouth bass): 119899190
Help
Entry
119899190 CDS
T07309
Symbol
cdkn2d
Name
(RefSeq) cyclin-dependent kinase 4 inhibitor D
KO
K06623
cyclin-dependent kinase inhibitor 2D
Organism
msam
Micropterus salmoides (largemouth bass)
Pathway
msam04068
FoxO signaling pathway
msam04110
Cell cycle
Brite
KEGG Orthology (KO) [BR:
msam00001
]
09130 Environmental Information Processing
09132 Signal transduction
04068 FoxO signaling pathway
119899190 (cdkn2d)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
119899190 (cdkn2d)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Ank_2
Ank
Ank_4
Ank_5
Ank_3
Nitrophorin
Motif
Other DBs
NCBI-GeneID:
119899190
NCBI-ProteinID:
XP_038569590
LinkDB
All DBs
Position
Unknown
AA seq
164 aa
AA seq
DB search
MVLSQMDAGKALTAAAAKGNTSEVLRILEECRVHPDTLNEFGRTALQVMMMGNSKIASLL
LEKGADPNVQDKHGIAPIHDAARTGFLDTVQVLVEYGALVNIPDQSGALPIHIAIREGHR
DVVEFLAPRSDLKHANVSGQTAIDVARASRLPDMIDLLFAHIHS
NT seq
495 nt
NT seq
+upstream
nt +downstream
nt
atggtccttagtcagatggatgccggtaaagctttgacggcggcagcagccaaaggaaat
acaagcgaggtgctgaggatcctggaggaatgcagagtgcatcctgatactctcaatgaa
tttggcaggactgcgctacaggtgatgatgatggggaactccaagatcgccagtttgctg
ttggaaaaaggagcagatcccaacgtgcaggacaaacacgggatagcgcccatccatgat
gcagcccggacaggattcctggacactgtgcaggttctggtggagtacggcgctttggta
aacatcccggaccagagtggtgccctgcctatccacatcgccatccgagaaggccaccgt
gatgtcgtggagttcttggcgccacggtctgacctgaagcatgccaacgtcagcggtcag
acagcgatagacgtggcccgagcttcacgtttgcccgatatgattgacttgctttttgct
cacattcatagttag
DBGET
integrated database retrieval system