Micropterus salmoides (largemouth bass): 119909001 Help Entry 119909001         CDS       T07309                                  Symbol dynlt1b Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04814   Motor proteins msam05132   Salmonella infection Brite KEGG Orthology (KO) [BR:msam00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     119909001 (dynlt1b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119909001 (dynlt1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:msam03037]     119909001 (dynlt1b)    04812 Cytoskeleton proteins [BR:msam04812]     119909001 (dynlt1b) Cilium and associated proteins [BR:msam03037]  Motile cilia and associated proteins   Dynein arm    119909001 (dynlt1b) Cytoskeleton proteins [BR:msam04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      119909001 (dynlt1b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PTP2 Motif Other DBs NCBI-GeneID:  119909001 NCBI-ProteinID:  XP_038582935 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDEFHTEDETGFVVEEVSKIIKESVEAAIGGNAYQHSRVNQWTASVVEQCLSQLSKLGKS FKYIVTCIIMQKNGAGLQTASACFWENSTDGSCAVRWENKSMYCIVNVFGLGI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgagttccatacagaagatgagactggattcgtcgttgaagaagtgagcaaaata attaaagagtcagtagaagcagcaataggaggaaatgcctaccagcacagcagagtgaac cagtggaccgccagcgtagtggagcagtgcctcagtcaactcagcaagctagggaagtct ttcaaatatattgtaacctgtatcatcatgcagaaaaatggagcaggtctgcaaacagcc agcgcatgcttctgggaaaactctactgatggaagttgtgcagtgagatgggagaacaag tccatgtactgtattgtcaatgtttttgggctgggcatctga

DBGET integrated database retrieval system