Micropterus salmoides (largemouth bass): 119915514 Help Entry 119915514         CDS       T07309                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:msam00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119915514  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:msam04121]     119915514    03400 DNA repair and recombination proteins [BR:msam03400]     119915514 Ubiquitin system [BR:msam04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      119915514    Cul5 complex      119915514 DNA repair and recombination proteins [BR:msam03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      119915514 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  119915514 NCBI-ProteinID:  XP_038590992 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRTPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATIGLAFRINDEMFEQLHVEAFSSPPELPDVMKPQDSGSTVNEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcataagaccacaatcttcacagatgccaaggag tccaccactgtctatgagctgaagcgcattgttgaaggaattcttaagcgaacacctgaa gaccaaaggctctacaaagatgaccagttgctagaggacagcaaaactcttggtgactgt ggattcaccaaccagactgccagaccccaggccccagctacaattggtctggccttccgc ataaatgatgagatgttcgaacagctgcatgttgaggccttctccagccctccagagctc ccagatgtgatgaagcctcaagactctggcagcaccgtcaacgaacaggctgtgcagtga

DBGET integrated database retrieval system