Micropterus salmoides (largemouth bass): 119919084 Help Entry 119919084         CDS       T07309                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04010   MAPK signaling pathway msam04137   Mitophagy - animal msam04140   Autophagy - animal msam04218   Cellular senescence msam04371   Apelin signaling pathway msam04625   C-type lectin receptor signaling pathway msam04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:msam00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119919084 (rras)    04371 Apelin signaling pathway     119919084 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119919084 (rras)    04137 Mitophagy - animal     119919084 (rras)   09143 Cell growth and death    04218 Cellular senescence     119919084 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     119919084 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119919084 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msam04147]     119919084 (rras)    04031 GTP-binding proteins [BR:msam04031]     119919084 (rras) Exosome [BR:msam04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    119919084 (rras)   Exosomal proteins of bladder cancer cells    119919084 (rras) GTP-binding proteins [BR:msam04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     119919084 (rras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  119919084 NCBI-ProteinID:  XP_038595514 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSGDEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEQQRVISREDAQAFARENRIHYMESSAKNRYNVDEVFLELVQIIRRFQEMECPPPQ AQHTGKKKSGGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcggagacgaggaaagattcaaactggtggtggtgggaggaggaggggtggggaag agcgccctgaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatc gaagactcctacaccaagatctgtaccgtggacggaaaggagacccggcttgacatcttg gatacagcaggtcaggaggagtttggggcgatgagggagcagtacatgcgctcaggagaa ggcttcttactggtgtttgcgctcaacgaccggggcagctaccatgaggtccagaaattc cacacccagatcctgagagtgaaggaccgagatgacttccccatggtactggttggtaac aaggctgacttggaacagcagagagtgatctccagggaggatgctcaggcgtttgccaga gagaacaggatccactacatggagtcttcggccaagaatcgctataacgtggatgaggtc ttcttggagctagtgcaaattatcagaaggtttcaggagatggagtgtcctcctcctcag gctcagcacacaggcaaaaagaagagtggtggctgtccctgtgtcctcctctaa

DBGET integrated database retrieval system