Mycolicibacterium sarraceniae: MSAR_00080 Help Entry MSAR_00080        CDS       T07083                                  Name (GenBank) hypothetical protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism msar  Mycolicibacterium sarraceniae Pathway msar00290   Valine, leucine and isoleucine biosynthesis msar00650   Butanoate metabolism msar00660   C5-Branched dibasic acid metabolism msar00770   Pantothenate and CoA biosynthesis msar01100   Metabolic pathways msar01110   Biosynthesis of secondary metabolites msar01210   2-Oxocarboxylic acid metabolism msar01230   Biosynthesis of amino acids Module msar_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine msar_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:msar00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     MSAR_00080    00660 C5-Branched dibasic acid metabolism     MSAR_00080   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     MSAR_00080   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     MSAR_00080 Enzymes [BR:msar01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      MSAR_00080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ALS_ss_C ACT_AHAS_ss ACT_5 PPR_long WSD Motif Other DBs NCBI-ProteinID:  BBY56872 UniProt:  A0A7I7SIU8 LinkDB All DBs Position complement(4940..5308) Genome browser AA seq 122 aa AA seqDB search MTIVVTAEETPLEQITKQLNKLINVIKIVEQDGDNFVARELALIKVRADAGTRSQVIEAV NLFRAKVIDVSTESLTVEATGTPEKLEALLRVLEPYGIREIVQSGVVLSRGPRDDQQQVK TP NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgacgatcgtggtcaccgccgaggagaccccgctcgaacagatcaccaagcagctcaac aagctgatcaacgtgatcaagatcgtcgagcaggacggtgacaacttcgtggcgcgcgag ctggcgctgatcaaggttcgagccgatgccggcacccgcagccaggtgatcgaagcggtg aacctgttccgcgccaaggtgatcgacgtgtccaccgagtctctgaccgtcgaagccacc ggcactcccgagaaactcgaagcgctgcttcgggtgctcgagccctacggcatccgcgag atcgtgcaatccggtgtggtgctgtcgcgcgggccgcgggatgaccaacaacaagtgaag accccgtag

DBGET integrated database retrieval system