Mycolicibacterium sarraceniae: MSAR_04420 Help Entry MSAR_04420        CDS       T07083                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism msar  Mycolicibacterium sarraceniae Pathway msar00074   Mycolic acid biosynthesis msar00280   Valine, leucine and isoleucine degradation msar00630   Glyoxylate and dicarboxylate metabolism msar00640   Propanoate metabolism msar01100   Metabolic pathways msar01110   Biosynthesis of secondary metabolites msar01120   Microbial metabolism in diverse environments msar01200   Carbon metabolism Module msar_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA msar_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:msar00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     MSAR_04420    00640 Propanoate metabolism     MSAR_04420   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     MSAR_04420   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     MSAR_04420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  BBY57306 UniProt:  A0A7I7SN82 LinkDB All DBs Position 396137..396415 Genome browser AA seq 92 aa AA seqDB search MSKHEDITELSDPRDITLDNPEPPAPEIRIEKGNPSDEDIAALVTVLAAASGGTAAPGPQ ELNLWGHPVDKLRYGIASWQRVTLLERMHLRR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagcaagcacgaggacatcaccgaactcagcgacccgcgggacatcacgctggacaat ccggagccaccggcaccggagattcggatcgagaagggcaatccgagcgacgaggatatc gccgctctggtgaccgtgctggccgctgccagtggcggcaccgccgcaccggggccgcag gagctcaacctgtggggccacccggtcgacaaactgcgctatggaatcgccagctggcag cgggtcacgctgctggagcggatgcacttgcgcagatga

DBGET integrated database retrieval system