Mycolicibacterium sarraceniae: MSAR_07770 Help Entry MSAR_07770        CDS       T07083                                  Name (GenBank) hypothetical protein   KO K04093   chorismate mutase [EC:5.4.99.5] Organism msar  Mycolicibacterium sarraceniae Pathway msar00400   Phenylalanine, tyrosine and tryptophan biosynthesis msar01100   Metabolic pathways msar01110   Biosynthesis of secondary metabolites msar01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:msar00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     MSAR_07770 Enzymes [BR:msar01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      MSAR_07770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  BBY57641 UniProt:  A0A7I7SMI4 LinkDB All DBs Position 737260..737532 Genome browser AA seq 90 aa AA seqDB search MTLKMVPEAEHDIDSLRGEIDQLDAAILAAVKRRTEVSQAIGKARMASGGTRLVHSREMK VIERYSELGQDGKDLAMLLLRMGRGRLGHS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgactctgaaaatggttcctgaagccgaacacgacatcgacagcctgcgcggcgagatc gaccagctcgatgctgcgatcctggctgcggtcaaacgccgcaccgaggtatcccaggcg atcggcaaggcccggatggcctccggcggcacccgactggtgcacagccgcgagatgaag gtcatcgagcgctacagcgagctcggccaggacggcaaggacctggcgatgttgctcctg cgcatgggccgcggccgactcgggcactcctag

DBGET integrated database retrieval system