Mucispirillum schaedleri: N508_001432 Help Entry N508_001432       CDS       T08201                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism msch  Mucispirillum schaedleri Pathway msch00020   Citrate cycle (TCA cycle) msch00720   Other carbon fixation pathways msch01100   Metabolic pathways msch01110   Biosynthesis of secondary metabolites msch01120   Microbial metabolism in diverse environments msch01200   Carbon metabolism msch01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:msch00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     N508_001432   09102 Energy metabolism    00720 Other carbon fixation pathways     N508_001432 Enzymes [BR:msch01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      N508_001432 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_9 Fer4_2 Fer4_7 Fer4_10 Fer4_6 Fer4_16 Fer4_4 LdpA_Fe-S-bd Fer4_17 Fer4_8 Fer4_15 DUF4590 Motif Other DBs NCBI-ProteinID:  USF24346 UniProt:  V2QB80 LinkDB All DBs Position complement(1505120..1505311) Genome browser AA seq 63 aa AA seqDB search MAKSEIKIYKERCKGCEICVVLCPAQVLDMQDFKVHIADIEKCTACMQCELRCPDFAIEV TRL NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaagtgaaataaaaatatataaagaaaggtgcaaaggctgcgaaatatgcgtt gtgctttgtcctgcacaggtgcttgatatgcaggattttaaagtgcatattgcagatata gaaaaatgcacagcatgtatgcagtgtgagttaagatgtcctgattttgcaatagaagtt acgaggttatag

DBGET integrated database retrieval system