Myxococcus stipitatus: MYSTI_03312 Help Entry MYSTI_03312       CDS       T02436                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism msd  Myxococcus stipitatus Pathway msd01100   Metabolic pathways msd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MYSTI_03312    00074 Mycolic acid biosynthesis     MYSTI_03312   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MYSTI_03312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGC44624 UniProt:  L7UDU9 LinkDB All DBs Position complement(4160632..4160892) Genome browser AA seq 86 aa AA seqDB search MQALEQEITKLVIETLNLEDLQPSDIDPIAPLFVEGLGLDSIDALELGLALQKTYGVALA SDSTENRRHFASVRALATFVSTHRKA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgcttgagcaggaaatcacgaagctggtcatcgagacgctgaacctcgaggac ctccagccgtcggacatcgacccgatagccccgctgttcgtcgaggggctggggctcgat tccatcgatgccttggagcttggcctcgcgctccagaagacctatggggttgccctggcg agcgattccacggagaaccgccgtcacttcgccagcgtgcgtgccctcgcgaccttcgtg agcacccaccgcaaggcctga

DBGET integrated database retrieval system